PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00016648-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 112aa    MW: 12779.6 Da    PI: 9.0247
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00016648-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1262e-0850941559
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 15 eAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59
                       +++  R+RKka++  Le++vk +e +N +L ++l++l++e   l
  PSME_00016648-RA 50 MSSQQARERKKAYLNDLETRVKDIELKNYELEERLSTLQNENHML 94
                      688999**********************************98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.2E-115092No hitNo description
SuperFamilySSF579591.0E-85099No hitNo description
CDDcd147042.32E-125192No hitNo description
PfamPF001701.2E-65195IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MEGMLSGPYS CVSMRLENPY PPLALLPTGR EGEPLQTRNT RVSKDFLGTM SSQQARERKK  60
AYLNDLETRV KDIELKNYEL EERLSTLQNE NHMLRYILKN TTMKNGSGNL GA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A3e-1461100342Transcription factor HY5
2oqq_B3e-1461100342Transcription factor HY5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0846365e-92EF084636.1 Picea sitchensis clone WS02719_D24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515537.15e-26PREDICTED: transcription factor HY5
SwissprotO246461e-24HY5_ARATH; Transcription factor HY5
SwissprotQ9SM501e-24HY5_SOLLC; Transcription factor HY5
TrEMBLA9NTI74e-37A9NTI7_PICSI; Putative uncharacterized protein
STRINGVIT_04s0008g05210.t011e-23(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.18e-26bZIP family protein